TF Information

GRMZM2G161666 *(Zea mays)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	GRMZM2G161666	T254312_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL15 M06992_2.00	Arabidopsis thaliana	WNTTWCCHAAWDWRGAAAN	NTTTCYWHWTTDGGWAANW	Dap-seq OMalley et al.(2016) AGL15_col_a	0.729	0.729
AGL15 M06993_2.00	Arabidopsis thaliana	DNTTWCCHAAWDDRGAAANHH	DDNTTTCYHHWTTDGGWAANH	Dap-seq OMalley et al.(2016) AGL15_colamp_a	0.729	0.729
AGL15 M10927_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL15_01	0.729	0.729
AGL15 M10928_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL15_02	0.729	0.729
M17_MAIZE M10959_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$M17_01	0.729	0.729
Q9ATE8_PETHY M11011_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP21_01	0.708	0.708
Q9ATE2_PETHY M11007_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP29_01	0.708	0.708
Q40591_TOBAC M11002_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS1_03	0.708	0.708
Q7X9I6_MALDO M11023_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS12_02	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GRMZM2G161666_P01	MADS box	10	57	RVENRVSRQVTFSKRRKGLLKKADELAVLCGVDVGVVVFSERGKLFEY

Links
Other MADS box family TFs
Other *Zea mays* TFs

Invalid Input OrderBy

97 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action