TF Information

GSMUA_Achr8G07230_001 *(Musa acuminata)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	GSMUA_Achr8G07230_001	T254403_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
A1YJE4_HORVD M10900_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BM10_01	0.729	0.729
MADS50 M10968_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS50_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr8P07230_001	MADS box	20	67	RIESEEARQVCFSKRRAGLFKKANELSVLCGAELALIVFSPAGKPFSF

Links
Other MADS box family TFs
Other *Musa acuminata* TFs

Invalid Input OrderBy

135 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action