TF Information

MTR_1g029670 *(Medicago truncatula)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	MTR_1g029670	T254699_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FBP1_PETHY M10996_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP1_01	0.833	0.833
MADS2_PETHY M10998_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS2_01	0.812	0.812
Q9AVU7_MALDO M11027_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PI_01	0.792	0.792
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KEH40496	MADS box	10	57	RIENSSNRQVTYSKRKSGILKKAKEINVLCDAQVSTIIIAPSGKMHEY

Links
Other MADS box family TFs
Other *Medicago truncatula* TFs

Invalid Input OrderBy

42 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action