TF Information

OPUNC06G24880 *(Oryza punctata)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	OPUNC06G24880	T255331_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MADS16 M10971_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS16_01	0.935	0.935
Q40513_TOBAC M11001_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DEF_01	0.761	0.761
AP3 M08146_2.00	Arabidopsis thaliana	WDCCMAAARWRGHAA	TTDCYWYTTTKGGHW	ChIP-seq Mathelier et al.(2014) MA0556.1	0.739	0.739
AP3 M10919_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADSB_Q2	0.739	0.739
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OPUNC06G24880.1	MADS box	10	55	RIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGNIK

Links
Other MADS box family TFs
Other *Oryza punctata* TFs

Invalid Input OrderBy

87 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action