TF Information

PRUPE_ppa014844mg *(Prunus persica)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	PRUPE_ppa014844mg	T255909_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FBP24_PETHY M10997_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP24_01	0.833	0.833
M17_MAIZE M10959_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$M17_01	0.750	0.750
Q9ATE9_PETHY M11012_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP20_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMJ13572	MADS box	10	57	RIENRTTRQVTFAKRRAGLIKKTHELSVLCDAQIGLVIFSSTGKMFQY

Links
Other MADS box family TFs
Other *Prunus persica* TFs

Invalid Input OrderBy

122 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action