TF Information

Sb06g017660 *(Sorghum bicolor)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	Sb06g017660	T256076_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL12 M10906_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL12_01	0.787	0.787
MADS26 M10974_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS26_01	0.766	0.766
MADS50 M10968_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS50_01	0.702	0.702
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Sb06g017660.1	MADS box	10	56	KIENPVHRQVTFCKRRMGLLKKAKELSVLCDAAIGVIVISPHGKIYD

Links
Other MADS box family TFs
Other *Sorghum bicolor* TFs

Invalid Input OrderBy

126 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action