TF Information

Traes_6DL_609A01BD5 *(Triticum aestivum)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	Traes_6DL_609A01BD5	T256594_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MAD55_ORYSJ M10962_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS55_01	0.708	0.708
Q4U0F1_WHEAT M10978_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TAVRT2_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_6DL_609A01BD5.1	MADS box	20	67	RIESEEARQVCFSKRRAGLFKKVSELAVLCGAEVAAVVFSPAGKAFSF

Links
Other MADS box family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

107 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action