TF Information

TRIUR3_09266 *(Triticum urartu)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	TRIUR3_09266	T256651_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL16 M06987_2.00	Arabidopsis thaliana	TWCCHAAWDDGGWAA	TTWCCHHWTTDGGWA	Dap-seq OMalley et al.(2016) AGL16_col_a	0.750	0.750
AGL16 M06988_2.00	Arabidopsis thaliana	WDWNTTWCCHWAWWDGGAAAS	STTTCCHWWTWDGGWAANWHW	Dap-seq OMalley et al.(2016) AGL16_colamp_a	0.750	0.750
Q9FVN1_MAIZE M10982_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS2_03	0.729	0.729
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
TRIUR3_09266-P1	MADS box	14	61	RIEKMSSRQVTFSKRRHGLMKKAHELAILCDVQVGVIVFSSTGRLYEY

Links
Other MADS box family TFs
Other *Triticum urartu* TFs

Invalid Input OrderBy

371 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action