TF Information

TRIUR3_27077 *(Triticum urartu)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	TRIUR3_27077	T256686_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SOC1 M08425_2.00	Arabidopsis thaliana	CCAAAAAWRGAAAND	HNTTTCYWTTTTTGG	ChIP-chip Mathelier et al.(2014) MA0554.1	0.708	0.708
SOC1 M10915_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL20_01	0.708	0.708
MADS50 M10968_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS50_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
TRIUR3_27077-P1	MADS box	11	58	RIENRTSRQGRFSKRRSGLFKKAFELALLCDTEVSLLVFSPAGRFYEY

Links
Other MADS box family TFs
Other *Triticum urartu* TFs

Invalid Input OrderBy

168 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action