TF Information

GOA *(Vitis vinifera)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	VIT_02s0025g02350	T256772_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FBP24_PETHY M10997_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP24_01	0.854	0.854
squamosa M02697_2.00	Antirrhinum majus	MYAWAWAWRGHAAN	NTTDCYWTWTWTRK	SELEX Mathelier et al.(2014) MA0082.1	0.729	0.729
O82695_MALDO M11019_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS5_01	0.729	0.729
Q38742_ANTMA M11000_2.00	Antirrhinum majus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SQUA_01	0.729	0.729
M17_MAIZE M10959_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$M17_01	0.708	0.708
Q8GT99_TOBAC M11006_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS11_02	0.708	0.708
Q9SBQ1_PETHY M11017_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PFG_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
VIT_02s0025g02350.t01	MADS box	10	57	KIEDKTVRQITFSKRRAGLLKKTHELSVLCDAQIGLIIFSNTGKMFEY

Links
Other MADS box family TFs
Other *Vitis vinifera* TFs

Invalid Input OrderBy

163 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action