TF Information

estExt_Genewise1.C_80073 *(Physcomitrella patens)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	estExt_Genewise1.C_80073	T257338_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL1 M02694_2.00	Arabidopsis thaliana	NDTDCCWWWWNDGGWAHN	NDTWCCHNWWWWGGHAHN	SELEX Mathelier et al.(2014) MA0585.1	0.708	0.708
AGL1 M10920_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL1_01	0.708	0.708
AGL1 M10921_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL1_02	0.708	0.708
MADS50 M10968_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS50_01	0.708	0.708
SHP2 M10914_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SHP2_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
estExt_Genewise1.C_80073	MADS box	10	57	KIENPTNRQVTYSKRRNGLMKKAYELSVLCDIDLALVMFSPSGKLTQY

Links
Other MADS box family TFs
Other *Physcomitrella patens* TFs

Invalid Input OrderBy

228 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action