TF Information

Lus10007100.g *(Linum usitatissimum)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	Lus10007100.g	T258537_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
A1YJE4_HORVD M10900_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BM10_01	0.708	0.708
O82698_MALDO M11021_2.00	Malus domestica	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS10_01	0.708	0.708
MADS18 M10973_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS18_01	0.708	0.708
MADS50 M10968_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS50_01	0.708	0.708
Solyc05g012020.2 M10986_2.00	Solanum lycopersicum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$RIN_01	0.708	0.708
Solyc05g012020.2 M10987_2.00	Solanum lycopersicum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$RIN_Q2_01	0.708	0.708
Solyc05g012020.2 M10988_2.00	Solanum lycopersicum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$RIN_Q2	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Lus10007100	MADS box	10	57	RIDDRTNRQVTFSKRRTGLIKKAKELSILCDAQIALIVFSTTNKLYQF

Links
Other MADS box family TFs
Other *Linum usitatissimum* TFs

Invalid Input OrderBy

325 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action