TF Information

MDP0000278738 *(Malus domestica)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	MDP0000278738	T258720_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FBP24_PETHY M10997_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP24_01	0.854	0.854
M17_MAIZE M10959_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$M17_01	0.729	0.729
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
MDP0000278738	MADS box	10	57	RIENKTTRQVTFAKRRAGLIKKTHELSVLCDAQIGLFIFSSTGKMFQY

Links
Other MADS box family TFs
Other *Malus domestica* TFs

Invalid Input OrderBy

131 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action