TF Information

ENSPPYG00000017826 *(Pongo abelii)* mTERF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02536 (mTERF)	IPR003690	ENSPPYG00000017826	T262469_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MTERF1 M11036_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$MTERF_01	0.942	0.942
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSPPYP00000019979	mTERF	103	410	LKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTSAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFKNPFILIQSTKRVKANIEFLQSTFSLNSEELLILICGPGAEILDLSNDYARRSYTNIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENIRISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLAIL

Links
Other mTERF family TFs
Other *Pongo abelii* TFs

Invalid Input OrderBy

31 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action