TF Information

MYB32 *(Arabidopsis thaliana)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	AT4G34990	T266505_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Encodes a R2R3 MYB protein which is involved in the response to UV-B. It functions as a repressor of target gene expression. One of its target genes encodes cinnamate 4-hydroxylase; mutants accumulate sinapate esters in their leaves. MYB4 binds to its own promoter and represses its own expression. Nuclear localization of MYB4 depends on the action of the beta importin SAD2.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MYB4 M02303_2.00	Arabidopsis thaliana	YACCWACY	RGTWGGTR	PBM Weirauch et al.(2014) pTH7075	0.813	0.882
MYB4 M07115_2.00	Arabidopsis thaliana	NYYACCWAMHWHNDD	HHNDWDKTWGGTRRN	Dap-seq OMalley et al.(2016) MYB4_col200_a	0.813	0.882
MYB3 M02288_2.00	Arabidopsis thaliana	NNYACCTACCN	NGGTAGGTRNN	PBM Weirauch et al.(2014) pTH7125	0.782	0.871
MYB51 M07010_2.00	Arabidopsis thaliana	NHNHHNHNNNYYYACCWACYW	WRGTWGGTRRRNNNDNDDNDN	Dap-seq OMalley et al.(2016) MYB51_col_a	0.672	0.731
MYB108 M07065_2.00	Arabidopsis thaliana	RCCWAAYYNNNNHNH	DNDNNNNRRTTWGGY	Dap-seq OMalley et al.(2016) BOS1_col_a	0.665	0.699
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT4G34990.1	Myb	14	61	KGAWTKEEDDKLISYIKAHGEGCWRSLPRSAGLQRCGKSCRLRWINYL
AT4G34990.1	Myb	67	112	RGNFTLEEDDLIIKLHSLLGNKWSLIATRLPGRTDNEIKNYWNTHV

Links
Other Myb/SANT family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

641 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action