TF Information

MYB56 *(Arabidopsis thaliana)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	AT5G17800	T266538_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Member of the R2R3 factor gene family that acts as a cell-specific repressor of quiescent center (QC) divisions in the primary root, acting through the BR signaling pathway. Works with BES1 to regulate QC division in the root.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MYB56 M07130_2.00	Arabidopsis thaliana	DDHNHTAACKGWHWH	DWDWCMGTTADNDHH	Dap-seq OMalley et al.(2016) MYB56_col_a	(Direct)	(Direct)
MYB56 M07131_2.00	Arabidopsis thaliana	DNNHTAACGGWHWHD	HDWDWCCGTTADNNH	Dap-seq OMalley et al.(2016) MYB56_colamp_a	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MYB105 M07031_2.00	Arabidopsis thaliana	TAACGGTWWHDDW	WHHDWWACCGTTA	Dap-seq OMalley et al.(2016) MYB105_col_a	0.754	0.828
MYB105 M07032_2.00	Arabidopsis thaliana	NNDWHDHTAACGGWWWH	DWWWCCGTTADHDWHNN	Dap-seq OMalley et al.(2016) MYB105_colamp_a	0.754	0.828
MYB52 M00871_2.00	Arabidopsis thaliana	NNNAMCNDNN	NNHNGKTNNN	PBM Franco-Zorrilla et al.(2014) MYB52	0.737	0.763
MYB52 M07007_2.00	Arabidopsis thaliana	TAACGGTNHHD	HDDNACCGTTA	Dap-seq OMalley et al.(2016) MYB52_col_a	0.737	0.763
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT5G17800.1	Myb	93	139	RGHWRPTEDAKLKELVAQFGPQNWNLISNHLLGRSGKSCRLRWFNQL
AT5G17800.1	Myb	145	190	KRAFTEEEEFRLLAAHRAYGNKWALISRLFPGRTDNAVKNHWHVIM

Links
Other Myb/SANT family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

385 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action