TF Information

AtMYB19 *(Arabidopsis thaliana)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	AT5G52260	T266562_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: LAF1 is a R2R3-MYB transcription factor and positive regulator of the phyA photoresponse. Interaction of LAF1 with HFR1 stabilize the proteins against ubiquitination by COP1(AT2G32950) and subsequent degrations. Mutants have an elongated hypocotyl specifically under far-red light but retain wild-type responses to other light wavelengths.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MYB55 M00876_2.00	Arabidopsis thaliana	ACCWAMCD	HGKTWGGT	PBM Franco-Zorrilla et al.(2014) MYB55	0.681	0.688
MYB55 M07102_2.00	Arabidopsis thaliana	HNNNHBYAMCWAMCD	HGKTWGKTRVDNNND	Dap-seq OMalley et al.(2016) MYB55_colamp_a	0.681	0.688
MYB55 M07103_2.00	Arabidopsis thaliana	NYNYAMCHACCRHH	DDYGGTDGKTRNRN	Dap-seq OMalley et al.(2016) MYB55_col	0.681	0.688
MYB61 M07002_2.00	Arabidopsis thaliana	HNYAMCHACCDNHNH	DNDNHGGTDGKTRND	Dap-seq OMalley et al.(2016) MYB61_col_a	0.679	0.699
MYB61 M07003_2.00	Arabidopsis thaliana	NHNYACCWAMCDH	DHGKTWGGTRNDN	Dap-seq OMalley et al.(2016) MYB61_colamp_a	0.679	0.699
MYB58 M07005_2.00	Arabidopsis thaliana	NNYYYACCWAMCHHH	DDDGKTWGGTRRRNN	Dap-seq OMalley et al.(2016) MYB58_col_a	0.666	0.667
MYB58 M07006_2.00	Arabidopsis thaliana	HNNYHYACCWAMCHHHNNNNH	DNNNNDDDGKTWGGTRDRNND	Dap-seq OMalley et al.(2016) MYB58_colamp_a	0.666	0.667
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT5G52260.1	Myb	14	61	KGLWSPEEDQKLKSFILSRGHACWTTVPILAGLQRNGKSCRLRWINYL
AT5G52260.1	Myb	67	112	RGSFSEEEEETILTLHSSLGNKWSRIAKYLPGRTDNEIKNYWHSYL

Links
Other Myb/SANT family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

423 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action