TF Information

ORGLA06G0168900 *(Oryza glaberrima)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	ORGLA06G0168900	T276765_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Gam1 M02703_2.00	Hordeum vulgare	NVYAACSGMC	GKCSGTTRBN	SELEX Mathelier et al.(2014) MA0034.1	0.700	0.728
Gam1 M11061_2.00	Hordeum vulgare	YAACSRHM	KDYSGTTR	Transfac Matys et al.(2006) P$GAMYB_01	0.700	0.728
GAM1_ORYSI M11055_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$GAMYB_Q2	0.700	0.728
myb.Ph3 M02704_2.00	Petunia x hybrida	WAACNGTYW	WRACNGTTW	SELEX Mathelier et al.(2014) MA0054.1	0.694	0.761
myb.Ph3 M11070_2.00	Petunia x hybrida	RTAACSGTTTYHW	WDRAAACSGTTAY	Transfac Matys et al.(2006) P$MYBPH3_01	0.694	0.761
myb.Ph3 M11071_2.00	Petunia x hybrida	STAACTAACTHHH	DDDAGTTAGTTAS	Transfac Matys et al.(2006) P$MYBPH3_02	0.694	0.761
MYB101 M07051_2.00	Arabidopsis thaliana	NWHHNWAACCGWWHH	DDWWCGGTTWNDDWN	Dap-seq OMalley et al.(2016) MYB101_col_a	0.690	0.739
MYB101 M07052_2.00	Arabidopsis thaliana	DHHHVTAACYGWHWN	NWDWCRGTTABDDDH	Dap-seq OMalley et al.(2016) MYB101_colamp_a	0.690	0.739
Q9FR42_TOBAC M11076_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MYBAS1_01	0.686	0.739
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ORGLA06G0168900.1	Myb	247	294	KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL
ORGLA06G0168900.1	Myb	300	344	KGPFSKEEEEMIIKLHLWLGNKWAKMANSLPGRTDNEIKNFWNTR

Links
Other Myb/SANT family TFs
Other *Oryza glaberrima* TFs

Invalid Input OrderBy

218 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action