TF Information

Ca_17627 *(Cicer arietinum)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Ca_17627	T283069_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q2TCH0_PETHY M11072_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PH4_01	0.742	0.796
MYB4 M02303_2.00	Arabidopsis thaliana	YACCWACY	RGTWGGTR	PBM Weirauch et al.(2014) pTH7075	0.707	0.763
MYB4 M07115_2.00	Arabidopsis thaliana	NYYACCWAMHWHNDD	HHNDWDKTWGGTRRN	Dap-seq OMalley et al.(2016) MYB4_col200_a	0.707	0.763
MYB3 M02288_2.00	Arabidopsis thaliana	NNYACCTACCN	NGGTAGGTRNN	PBM Weirauch et al.(2014) pTH7125	0.703	0.753
MYB62 M07027_2.00	Arabidopsis thaliana	NHRCCTAAYTWNHNN	NNDNWARTTAGGYDN	Dap-seq OMalley et al.(2016) MYB62_col_a	0.673	0.656
MYB62 M07028_2.00	Arabidopsis thaliana	HNKRCCTAACTHH	DDAGTTAGGYMND	Dap-seq OMalley et al.(2016) MYB62_colamp_a	0.673	0.656
WER M11047_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WEREWOLF_Q2_01	0.666	0.710
WER M11048_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WEREWOLF_Q2	0.666	0.710
ATMYB121 M07091_2.00	Arabidopsis thaliana	NYNWACCTAMYHHH	DDDRKTAGGTWNRN	Dap-seq OMalley et al.(2016) MYB121_col_a	0.665	0.656
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ca_17627	Myb	14	61	KGPWTPKEDTLLTKYVQAHGEGQWKSLPKKAGLLRCGKSCRLRWMNYL
Ca_17627	Myb	67	112	RGNISPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTYL

Links
Other Myb/SANT family TFs
Other *Cicer arietinum* TFs

Invalid Input OrderBy

731 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action