TF Information

cassava36364.valid.m1 *(Manihot esculenta)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	cassava36364.valid.m1	T284231_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MYB3 M02288_2.00	Arabidopsis thaliana	NNYACCTACCN	NGGTAGGTRNN	PBM Weirauch et al.(2014) pTH7125	0.707	0.731
Q2TCH0_PETHY M11072_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PH4_01	0.705	0.785
GRMZM2G005066 M11056_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$C1_Q2	0.696	0.720
MYB62 M07027_2.00	Arabidopsis thaliana	NHRCCTAAYTWNHNN	NNDNWARTTAGGYDN	Dap-seq OMalley et al.(2016) MYB62_col_a	0.687	0.667
MYB62 M07028_2.00	Arabidopsis thaliana	HNKRCCTAACTHH	DDAGTTAGGYMND	Dap-seq OMalley et al.(2016) MYB62_colamp_a	0.687	0.667
MYB4 M02303_2.00	Arabidopsis thaliana	YACCWACY	RGTWGGTR	PBM Weirauch et al.(2014) pTH7075	0.687	0.731
MYB4 M07115_2.00	Arabidopsis thaliana	NYYACCWAMHWHNDD	HHNDWDKTWGGTRRN	Dap-seq OMalley et al.(2016) MYB4_col200_a	0.687	0.731
MYB111 M00882_2.00	Arabidopsis thaliana	NNNAMCDAMY	RKTHGKTNNN	PBM Franco-Zorrilla et al.(2014) MYB111	0.666	0.731
MYB113 M07026_2.00	Arabidopsis thaliana	VTAACKRAHTH	DADTYMGTTAB	Dap-seq OMalley et al.(2016) MYB113_col_a	0.661	0.677
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
cassava36364.valid.m1	Myb	14	61	RGAWTAQEDKLLTDYIKLHGEGKWGNLPKRAGLKRCGKSCRLRWLNYL
cassava36364.valid.m1	Myb	67	112	RGNISPDEEDLIIRLHRLLGNRWSLIAGRLPGRTDNEIKNYWNTNL

Links
Other Myb/SANT family TFs
Other *Manihot esculenta* TFs

Invalid Input OrderBy

881 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action