TF Information

cassava36365.valid.m1 *(Manihot esculenta)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	cassava36365.valid.m1	T284232_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q2TCH0_PETHY M11072_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PH4_01	0.718	0.774
MYB111 M00882_2.00	Arabidopsis thaliana	NNNAMCDAMY	RKTHGKTNNN	PBM Franco-Zorrilla et al.(2014) MYB111	0.707	0.742
GRMZM2G005066 M11056_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$C1_Q2	0.700	0.710
ATMYB13 M06999_2.00	Arabidopsis thaliana	HYCACCWACCHHHNH	DNDDDGGTWGGTGRD	Dap-seq OMalley et al.(2016) MYB13_col_a	0.675	0.720
ATMYB13 M07000_2.00	Arabidopsis thaliana	BYCACCWACCHHHNNHNN	NNDNNDDDGGTWGGTGRV	Dap-seq OMalley et al.(2016) MYB13_colamp_a	0.675	0.720
MYB3 M02288_2.00	Arabidopsis thaliana	NNYACCTACCN	NGGTAGGTRNN	PBM Weirauch et al.(2014) pTH7125	0.671	0.720
MYB4 M02303_2.00	Arabidopsis thaliana	YACCWACY	RGTWGGTR	PBM Weirauch et al.(2014) pTH7075	0.667	0.720
MYB4 M07115_2.00	Arabidopsis thaliana	NYYACCWAMHWHNDD	HHNDWDKTWGGTRRN	Dap-seq OMalley et al.(2016) MYB4_col200_a	0.667	0.720
PK06182.1 M02349_2.00	Cannabis sativa	WTACCTACCN	NGGTAGGTAW	PBM Weirauch et al.(2014) pTH9581	0.661	0.731
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
cassava36365.valid.m1	Myb	14	61	RGPWSAPEDKILVNYIKLHGEGKWRDLPRRAGLKRCGKSCRLRWLNYL
cassava36365.valid.m1	Myb	67	112	RGNISVDEEDLIIRLHKLLGNRWSLIAGRLPGRTDNEIKNYWNSHL

Links
Other Myb/SANT family TFs
Other *Manihot esculenta* TFs

Invalid Input OrderBy

644 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action