TF Information

estExt_fgenesh1_pg.C_1660037 *(Physcomitrella patens)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	estExt_fgenesh1_pg.C_1660037	T284675_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK26523.1 M01283_2.00	Cannabis sativa	NWHATTCYNN	NNRGAATDWN	PBM Lambert et al.(2019) pTH11304	0.815	0.872
AT2G40260 M07057_2.00	Arabidopsis thaliana	HHWDWAHATTCYHTN	NADRGAATDTWHWDD	Dap-seq OMalley et al.(2016) AT2G40260_col_a	0.794	0.809
AT2G40260 M07058_2.00	Arabidopsis thaliana	NNDDWHHNDDWAHATTCYHT	ADRGAATDTWHHNDDWHHNN	Dap-seq OMalley et al.(2016) AT2G40260_colamp_a	0.794	0.809
AT2G38300 M07056_2.00	Arabidopsis thaliana	WAHATTCYHTH	DADRGAATDTW	Dap-seq OMalley et al.(2016) AT2G38300_col_a	0.738	0.809
AT1G14600 M01268_2.00	Arabidopsis thaliana	NWAYATTCYN	NRGAATRTWN	PBM Lambert et al.(2019) pTH11557	0.699	0.787
KAN1 M00878_2.00	Arabidopsis thaliana	NNRTNBNN	NNVNAYNN	PBM Franco-Zorrilla et al.(2014) KAN1	0.666	0.745
KAN1 M02308_2.00	Arabidopsis thaliana	NDNDTAHNHN	NDNDTAHNHN	PBM Weirauch et al.(2014) pTH7135	0.666	0.745
KAN2 M07018_2.00	Arabidopsis thaliana	HHHNDWATATTCTYH	DRAGAATATWHNDDD	Dap-seq OMalley et al.(2016) KAN2_col_a	0.666	0.745
KAN2 M07019_2.00	Arabidopsis thaliana	NWWTATTCYYH	DRRGAATAWWN	Dap-seq OMalley et al.(2016) KAN2_colamp_a	0.666	0.745
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
estExt_fgenesh1_pg.C_1660037	Myb	239	290	RLRWTADLHRCFVVAVERLGGQEKATPKMVLQLMDVKGLTIAHVKSHLQMYR

Links
Other Myb/SANT family TFs
Other *Physcomitrella patens* TFs

Invalid Input OrderBy

656 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action