TF Information

Thhalv10016974m.g *(Eutrema salsugineum)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Thhalv10016974m.g	T290075_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ASR3 M07053_2.00	Arabidopsis thaliana	DNNNNHHWNDRCCCTWAW	WTWAGGGYHNWDDNNNNH	Dap-seq OMalley et al.(2016) AT2G33550_col_a	0.870	0.978
ASR3 M07054_2.00	Arabidopsis thaliana	NHWDDTRCCCTWMW	WKWAGGGYAHHWDN	Dap-seq OMalley et al.(2016) AT2G33550_colamp_a	0.870	0.978
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10016974m	Myb	46	113	PRWTRQEILVLIQGKRVAENRVRRGRAAGMALGSGQMEPKWASVSSYCRRHGVNRGPVQCRKRWSNLA

Links
Other Myb/SANT family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

38 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action