TF Information

AT3G12910 *(Arabidopsis thaliana)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02365 (NAM)	IPR003441	AT3G12910	T292066_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Similar to a putative transcription factor and transcriptional coactivators. Repressor of GA responses and involved in gibberellic acid mediated signaling. Member of the DELLA proteins that restrain the cell proliferation and expansion that drives plant growth. The protein undergoes degradation in response to GA via the 26S proteasome. GAI may be involved in reducing ROS accumulation in response to stress by up-regulating the transcription of superoxide dismutases. Represses GA-induced vegetative growth and floral initiation. Rapidly degraded in response to GA.
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT3G12910 M07204_2.00	Arabidopsis thaliana	YGSCGKNDNDDHNMCGB	VCGKNDHHNHNMCGSCR	Dap-seq OMalley et al.(2016) AT3G12910_col_a	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NAC002 M00970_2.00	Arabidopsis thaliana	NBACGYAWMN	NKWTRCGTVN	PBM Lindemose et al.(2014) ATAF1	0.931	0.544
NAC002 M07159_2.00	Arabidopsis thaliana	KVCGTRWNNNWHWHKNHHWYND	HNRWDDNMDWDWNNNWYACGBM	Dap-seq OMalley et al.(2016) ATAF1_col_a	0.931	0.544
NAC002 M07160_2.00	Arabidopsis thaliana	YACGY	RCGTR	Dap-seq OMalley et al.(2016) ATAF1_colamp_a	0.931	0.544
NAC48 M11084_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$NAC6_01	0.930	0.544
NAC101 M07241_2.00	Arabidopsis thaliana	TGCKTVNDNHNYAMG	CKTRNDNHNBAMGCA	Dap-seq OMalley et al.(2016) VND6_colamp_a	0.879	0.526
NAC101 M07242_2.00	Arabidopsis thaliana	TTGCKTVHDNNNYAMGYHWHN	NDWDRCKTRNNNHDBAMGCAA	Dap-seq OMalley et al.(2016) VND6_col_v31	0.879	0.526
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
AT3G12910.1	NAC/NAM	22	150	LPGFRFHPTDEELVGYYLSKKVLLKKTSKIDEIVSQIDIYKFDPWDLPRSRNTEKESYFFCKRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSDGSNKAVIGLKKTLVYYLGSAGKGNKTDWMMHEFRL

Links
Other NAC/NAM family TFs
Other *Arabidopsis thaliana* TFs

Invalid Input OrderBy

234 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action