TF Information

SELMODRAFT_47266 *(Selaginella moellendorffii)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02365 (NAM)	IPR003441	SELMODRAFT_47266	T295649_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NAC025 M02368_2.00	Arabidopsis thaliana	YACGYAAY	RTTRCGTR	PBM Weirauch et al.(2014) pTH7656	0.902	0.772
Traes_5BL_CC18CAD72 M11085_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$NAC691_01	0.889	0.807
NAC48 M11084_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$NAC6_01	0.880	0.737
NAC018 M07176_2.00	Arabidopsis thaliana	DYACGBMAYYD	HRRTKVCGTRH	Dap-seq OMalley et al.(2016) NAM_colamp_a	0.872	0.807
NAC018 M07177_2.00	Arabidopsis thaliana	WDNCKWNHNNNWYACGBMA	TKVCGTRWNNNDNWMGNHW	Dap-seq OMalley et al.(2016) NAM_col_v3a	0.872	0.807
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EFJ07841	NAC/NAM	10	134	PPGFRFHPTDEELVVHYLARRAASRPFAVPIIAEVDLYKFDPWDLPDKALFGEREWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKPISSDGCKVGVKKALVFYRGRAPKGSKTSWIMHEYRL

Links
Other NAC/NAM family TFs
Other *Selaginella moellendorffii* TFs

Invalid Input OrderBy

449 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action