TF Information

Cla013942 *(Citrullus lanatus)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02365 (NAM)	IPR003441	Cla013942	T296571_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NAC078 M02372_2.00	Arabidopsis thaliana	NNRCAMGHMANN	NNTKDCKTGYNN	PBM Weirauch et al.(2014) pTH7209	0.896	0.833
NAC078 M07226_2.00	Arabidopsis thaliana	TTDCTTGNDNNDCAAG	CTTGHNNHNCAAGHAA	Dap-seq OMalley et al.(2016) NAC2_colamp_a	0.896	0.833
NAC078 M07227_2.00	Arabidopsis thaliana	DTTWCTTGNNNNRCAAG	CTTGYNNNNCAAGWAAH	Dap-seq OMalley et al.(2016) NAC2_col_v3a	0.896	0.833
NAC078 M11083_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$NAC078_Q2	0.896	0.833
NAC053 M07202_2.00	Arabidopsis thaliana	TTWCTTGNNNVRCAAG	CTTGYBNNNCAAGWAA	Dap-seq OMalley et al.(2016) ANAC053_colamp_a	0.880	0.807
NAC053 M07203_2.00	Arabidopsis thaliana	TTWCTTGNNNVRCAAGH	DCTTGYBNNNCAAGWAA	Dap-seq OMalley et al.(2016) ANAC053_col	0.880	0.807
NAC053 M11079_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AT3G10500_Q2	0.880	0.807
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cla013942	NAC/NAM	10	136	APGFRFHPTDEEIVRYYLRRKVSGKSLRFDPISVTEIYKSEPWDLPGKSKLKTRDLEWYFFSPLDKKYGNSSRTNRATENGYWKTTGKDRPVRHNSRVVGMKKTLVYHSGRAPRGTRSNWVMHEYRL

Links
Other NAC/NAM family TFs
Other *Citrullus lanatus* TFs

Invalid Input OrderBy

40 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action