TF Information

Cagra.3375s0006 *(Capsella grandiflora)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02365 (NAM)	IPR003441	Cagra.3375s0006	T297428_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
anac016 M07172_2.00	Arabidopsis thaliana	DVCKTGNBNNNCAMG	CKTGNNNVNCAMGBH	Dap-seq OMalley et al.(2016) ANAC016_col_a	0.950	0.939
anac016 M07173_2.00	Arabidopsis thaliana	TVCKTGNBNNNCAMG	CKTGNNNVNCAMGBA	Dap-seq OMalley et al.(2016) ANAC016_colamp_a	0.950	0.939
NAC017 M07174_2.00	Arabidopsis thaliana	NCKTGNBNNNCAMGNWA	TWNCKTGNNNVNCAMGN	Dap-seq OMalley et al.(2016) ANAC017_colamp_v31	0.908	0.860
NAC017 M07175_2.00	Arabidopsis thaliana	NDNTTNCTTGBNNNNCAMG	CKTGNNNNVCAAGNAANHN	Dap-seq OMalley et al.(2016) ANAC017_col	0.908	0.860
NAC017 M11078_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AT1G34190_Q2	0.908	0.860
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cagra.3375s0006.1.p	NAC/NAM	13	139	APGFRFHPTDEELVVYYLKRKICGRKLRINAIGVVDVYKVDPSELPGLSMLKTGDRQWFFFTPRNRKYPNAARSSRGTVTGYWKATGKDRVIEYNSRSVGLKKTLVFYRGRAPNGERTDWVMHEYTM

Links
Other NAC/NAM family TFs
Other *Capsella grandiflora* TFs

Invalid Input OrderBy

19 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action