TF Information

Thhalv10001200m.g *(Eutrema salsugineum)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02365 (NAM)	IPR003441	Thhalv10001200m.g	T299200_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
anac096 M07237_2.00	Arabidopsis thaliana	CTTSHNNNNBAMGHAAYC	GRTTDCKTVNNNNDSAAG	Dap-seq OMalley et al.(2016) ANAC096_colamp_a	0.951	0.899
anac096 M07238_2.00	Arabidopsis thaliana	TTNCTTSWNNHNYAMG	CKTRNDNNWSAAGNAA	Dap-seq OMalley et al.(2016) ANAC096_col	0.951	0.899
anac071 M07219_2.00	Arabidopsis thaliana	CTTSHNNYHCAMGYW	WRCKTGDRNNDSAAG	Dap-seq OMalley et al.(2016) ANAC071_col_a	0.940	0.881
anac071 M07220_2.00	Arabidopsis thaliana	CTTSHNNNNSAMGYA	TRCKTSNNNNDSAAG	Dap-seq OMalley et al.(2016) ANAC071_colamp_a	0.940	0.881
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10001200m	NAC/NAM	7	134	PPGFRFHPTDEELIDYYLKRKVEGLEIELEVIPVIDLYKFDPWELPDKSFLPNRDMEWFFFCSRDKKYPNGFRTNRGTKAGYWKATGKDRKITCRSSSTIGYRKTLVFYKGRAPLGDRTSWLMHEYRL

Links
Other NAC/NAM family TFs
Other *Eutrema salsugineum* TFs

Invalid Input OrderBy

81 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action