TF Information

CBN08904 *(Caenorhabditis brenneri)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00105 (zf-C4)	IPR001628	CBN08904	T301721_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
daf-12 M00685_2.00	Caenorhabditis elegans	NDAGTRCANN	NNTGYACTHN	PBM Narasimhan et al.(2015) pTH9108	0.981	0.886
daf-12 M08159_2.00	Caenorhabditis elegans	GWGYGYGYKTGYDKB	VMHRCAMRCRCRCWC	ChIP-seq Mathelier et al.(2014) MA0538.1	0.981	0.886
Hr96 M03940_2.00	Drosophila melanogaster	YVRGTRCANVTGYACYBR	YVRGTRCABNTGYACYBR	SELEX Nitta et al.(2015) Hr96_1	0.911	0.686
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CBN08904	Nuclear receptor	50	119	KICRVCGDFATGYNFNVMTCESCKAFFRRNALRPKEFKCPYSENCTMSSVSRRFCQKCRLRKCFAVGMKK

Links
Other Nuclear receptor family TFs
Other *Caenorhabditis brenneri* TFs

Invalid Input OrderBy

105 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action