TF Information

CRE05044 *(Caenorhabditis remanei)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00105 (zf-C4)	IPR001628	CRE05044	T302053_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
nhr-142 M00703_2.00	Caenorhabditis elegans	RGTCACAR	YTGTGACY	PBM Narasimhan et al.(2015) pTH10714	0.833	0.514
nhr-232 M00700_2.00	Caenorhabditis elegans	NNTNTDWYN	NRWHANANN	PBM Narasimhan et al.(2015) pTH10647	0.800	0.471
nhr-182 M00701_2.00	Caenorhabditis elegans	DWBYGTGWCH	DGWCACRVWH	PBM Narasimhan et al.(2015) pTH10779	0.769	0.486
nhr-182 M00702_2.00	Caenorhabditis elegans	NNNHRTRNHN	NDNYAYDNNN	PBM Narasimhan et al.(2015) pTH6106	0.769	0.486
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CRE05044	Nuclear receptor	21	91	IPCEVCTYPSHGYHFKVMSCRACAAFYRRSLIAGLRYICKGRNNNCHIDSSVRYFCKSCRFQKCLKSGMSA

Links
Other Nuclear receptor family TFs
Other *Caenorhabditis remanei* TFs

Invalid Input OrderBy

50 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action