CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

nhr-60 *(Caenorhabditis elegans)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00105 (zf-C4)	IPR001628	WBGene00003650	T306174_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Predicted to enable RNA polymerase II cis-regulatory region sequence-specific DNA binding activity and nuclear receptor activity. Predicted to be involved in anatomical structure development; cell differentiation; and regulation of transcription by RNA polymerase II. Located in nuclear envelope. Is expressed in several structures, including VC neuron; pharyngeal gland cell; ray; seam cell; and uv1. Human ortholog(s) of this gene implicated in Fanconi renotubular syndrome 4; familial combined hyperlipidemia; hypoglycemia; maturity-onset diabetes of the young type 1; and type 2 diabetes mellitus. Orthologous to human HNF4A (hepatocyte nuclear factor 4 alpha) and HNF4G (hepatocyte nuclear factor 4 gamma). [provided by Alliance of Genome Resources, Apr 2022]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
nhr-168 M00699_2.00	Caenorhabditis elegans	NNNHHCRNHN	NDNYGDDNNN	PBM Narasimhan et al.(2015) pTH10013	0.976	0.800
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
F57A10.5	Nuclear receptor	45	116	TECLICGNSANGHHYDVASCNGCKTFFRRMCVSDRSFECKAKGDCFDLTKRKVPLKCRACRHQKCISVGMNP

Links
Other Nuclear receptor family TFs
Other *Caenorhabditis elegans* TFs