TF Information

estExt_fgenesh2_pg.C_1640037 *(Branchiostoma floridae)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00105 (zf-C4)	IPR001628	estExt_fgenesh2_pg.C_1640037	T306983_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NR1H3 M09264_2.00	Homo sapiens	NHRRGGBHABHNNRGGNCA	TGNCCYNNDVTDVCCYYDN	Misc Kulakovskiy et al.(2013) NR1H3_HUMAN.H11MO.0.B	0.870	0.686
Nr1h3 M09301_2.00	Mus musculus	VDGDNCARAGKBCAN	NTGVMCTYTGNHCHB	Misc Kulakovskiy et al.(2013) NR1H3_MOUSE.H11MO.0.A	0.870	0.686
nr1h5.S M11194_2.00	Xenopus laevis	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FXRIR1_Q6	0.829	0.629
ftz-f1 M02407_2.00	Drosophila melanogaster	RRGGTCAH	DTGACCYY	PBM Weirauch et al.(2014) pTH5709	0.826	0.471
ftz-f1 M06417_2.00	Drosophila melanogaster	MMRKYYSAAGGWCRCYGM	KCRGYGWCCTTSRRMYKK	B1H Zhu et al.(2011) ftz-f1_FlyReg_FBgn0001078	0.826	0.471
ftz-f1 M06418_2.00	Drosophila melanogaster	AAGGTCA	TGACCTT	B1H Zhu et al.(2011) ftz-f1_SANGER_5_FBgn0001078	0.826	0.471
Hr39 M03942_2.00	Drosophila melanogaster	CAAGGHCRN	NYGDCCTTG	SELEX Nitta et al.(2015) Hr39_1	0.821	0.500
Hr39 M03943_2.00	Drosophila melanogaster	CAAGGYCRH	DYGRCCTTG	SELEX Nitta et al.(2015) Hr39_2	0.821	0.500
Nr2f6 M00811_2.00	Mus musculus	NRRGGTCANN	NNTGACCYYN	PBM Weirauch et al.(2013) pTH2193	0.809	0.514
Nr2f6 M03419_2.00	Mus musculus	RAGGTCAADAGGTCA	TGACCTHTTGACCTY	SELEX Jolma et al.(2013) Nr2f6_1	0.809	0.514
Nr2f6 M03420_2.00	Mus musculus	RRGGTCAAAGGTCA	TGACCTTTGACCYY	SELEX Jolma et al.(2013) Nr2f6_2	0.809	0.514
Nr5a2 M00816_2.00	Mus musculus	VAAGGTCR	YGACCTTB	PBM Weirauch et al.(2013) pTH3468	0.806	0.457
Nr5a2 M08158_2.00	Mus musculus	VRDBTCAAGGYCANN	NNTGRCCTTGAVHYB	ChIP-seq Mathelier et al.(2014) MA0505.1	0.806	0.457
Nr5a2 M09320_2.00	Mus musculus	NBYCAAGGYCA	TGRCCTTGRVN	Misc Kulakovskiy et al.(2013) NR5A2_MOUSE.H11MO.0.A	0.806	0.457
Nr5a2 M09616_2.00	Mus musculus	BYCAAGGYCA	TGRCCTTGRV	Misc Heinz et al.(2010) Pancreas-LRH1_GSE34295	0.806	0.457
Nr5a2 M09615_2.00	Mus musculus	BYCAAGGYCA	TGRCCTTGRV	Misc Heinz et al.(2010) mES-Nr5a2_GSE19019	0.806	0.457
NR5A1 M05613_2.00	Homo sapiens	NNCAAGGYCRN	NYGRCCTTGNN	SELEX Yin et al.(2017) NR5A1_FL_HT-SELEX	0.805	0.471
Nr5a1 M09322_2.00	Mus musculus	NBYCAAGGYCA	TGRCCTTGRVN	Misc Kulakovskiy et al.(2013) STF1_MOUSE.H11MO.0.B	0.805	0.471
NR5A1 M11142_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SF1_Q5_01	0.805	0.471
NR5A1 M11143_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SF1_Q5	0.805	0.471
NR5A1 M11144_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SF1_Q6_01	0.805	0.471
NR5A1 M11145_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SF1_Q6	0.805	0.471
NR5A1 M05614_2.00	Homo sapiens	NNSAAGGHCRN	NYGDCCTTSNN	SELEX Yin et al.(2017) NR5A1_FL_Methyl-HT-SELEX	0.805	0.471
NR5A2 M05589_2.00	Homo sapiens	YCAAGGYCRYGRCCTTSR	YSAAGGYCRYGRCCTTGR	SELEX Yin et al.(2017) NR5A2_eDBD_HT-SELEX_1	0.800	0.457
NR5A2 M05590_2.00	Homo sapiens	NYCAAGGTCAH	DTGACCTTGRN	SELEX Yin et al.(2017) NR5A2_eDBD_HT-SELEX_2	0.800	0.457
NR5A2 M05591_2.00	Homo sapiens	YGRCCTTSVNYSAAGGYCR	YGRCCTTSRNBSAAGGYCR	SELEX Yin et al.(2017) NR5A2_eDBD_HT-SELEX_3	0.800	0.457
NR5A2 M09271_2.00	Homo sapiens	NBYCAAGGYCA	TGRCCTTGRVN	Misc Kulakovskiy et al.(2013) NR5A2_HUMAN.H11MO.0.B	0.800	0.457
NR5A2 M11126_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$LRH1_Q5_01	0.800	0.457
NR5A2 M11127_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$LRH1_Q5	0.800	0.457
NR5A2 M11128_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$LRH1_Q6	0.800	0.457
NR5A2 M05592_2.00	Homo sapiens	YCAAGGYCRYGACCTTSR	YSAAGGTCRYGRCCTTGR	SELEX Yin et al.(2017) NR5A2_eDBD_Methyl-HT-SELEX_1	0.800	0.457
NR5A2 M05593_2.00	Homo sapiens	NYCAAGGTCRH	DYGACCTTGRN	SELEX Yin et al.(2017) NR5A2_eDBD_Methyl-HT-SELEX_2	0.800	0.457
NR5A2 M05594_2.00	Homo sapiens	YGRCCTTSVNBSAAGGYCR	YGRCCTTSVNBSAAGGYCR	SELEX Yin et al.(2017) NR5A2_eDBD_Methyl-HT-SELEX_3	0.800	0.457
NR1H4 M00368_2.00	Homo sapiens	NVRGGTCANN	NNTGACCYBN	PBM Barrera et al.(2016) NR1H4_REF	0.797	0.614
NR1H4 M05876_2.00	Homo sapiens	DRGKTCAHHKD	HMDDTGAMCYH	SMiLE-seq Isakova et al.(2017) NR1H4	0.797	0.614
NR1H4 M08152_2.00	Homo sapiens	NNGGTCATTNN	NNAATGACCNN	ChIP-seq Mathelier et al.(2014) MA1110.1	0.797	0.614
NR1H4 M09263_2.00	Homo sapiens	CCBVNVGGYCRBTGMCCYB	VRGGKCAVYGRCCBNBVGG	Misc Kulakovskiy et al.(2013) NR1H4_HUMAN.H11MO.0.B	0.797	0.614
Nr1h4 M09332_2.00	Mus musculus	CCBVNVGGYCRBTGMCCYB	VRGGKCAVYGRCCBNBVGG	Misc Kulakovskiy et al.(2013) NR1H4_MOUSE.H11MO.0.A	0.797	0.614
Nr1h4 M09618_2.00	Mus musculus	NRGGBCANTGVCCY	RGGBCANTGVCCYN	Misc Heinz et al.(2010) Liver-FXR_Chong_et_al.	0.797	0.614
NR1H4 M11086_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FXR_Q2	0.797	0.614
NR1H4 M11087_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FXR_Q3	0.797	0.614
NR1H4 M11088_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FXR_Q5	0.797	0.614
NR1H4 M11089_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$FXRRXR_Q5	0.797	0.614
NR1H4 M00367_2.00	Homo sapiens	NNNTWTTATDHNN	NNDHATAAWANNN	PBM Barrera et al.(2016) NR1H4_C144R	0.797	0.600
nhr-25 M08226_2.00	Caenorhabditis elegans	MAAGGTCA	TGACCTTK	ChIP-seq Contrino et al.(2012) Mw160	0.786	0.443
EcR M06414_2.00	Drosophila melanogaster	RAGGTCAW	WTGACCTY	B1H Zhu et al.(2011) EcR_SANGER_5_FBgn0000546	0.783	0.629
Nr1h2 M09620_2.00	Mus musculus	RGGTYACTNNAGGTCA	TGACCTNNAGTRACCY	Misc Heinz et al.(2010) RAW-LXRb.biotin_GSE21512	0.752	0.614
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
estExt_fgenesh2_pg.C_1640037	Nuclear receptor	645	714	GDCVVCGDKGSGFHYGVYSCEGCKGFFRRTVTKGYVKACKSGSKCNMDMYTRRKCPECRLRSCRAAGMRS

Links
Other Nuclear receptor family TFs
Other *Branchiostoma floridae* TFs

Invalid Input OrderBy

670 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

estExt_fgenesh2_pg.C_1640037 (Branchiostoma floridae) Nuclear receptor

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

670 Related TFs

Invalid Input OrderBy

estExt_fgenesh2_pg.C_1640037 **(Branchiostoma floridae)
Nuclear receptor**