TF Information

SMU15038222 *(Schmidtea mediterranea)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00105 (zf-C4)	IPR001628	SMU15038222	T307209_2.00	Misc (2018-Jan-19)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GA30480 M02409_2.00	Drosophila pseudoobscura	RAGATCAM	KTGATCTY	PBM Weirauch et al.(2014) pTH5877	0.980	0.929
Hr51 M06432_2.00	Drosophila melanogaster	AMRDATCARARGW	WCYTYTGATHYKT	B1H Zhu et al.(2011) Hr51_SANGER_5_FBgn0034012	0.980	0.929
NR2E3 M00373_2.00	Homo sapiens	NRAGATCAMN	NKTGATCTYN	PBM Barrera et al.(2016) NR2E3_REF	0.967	0.814
Nr2e3 M02708_2.00	Mus musculus	AAGCTTD	HAAGCTT	SELEX Mathelier et al.(2014) MA0164.1	0.967	0.814
Nr2e3 M09328_2.00	Mus musculus	NAAGTCAAAARKCA	TGMYTTTTGACTTN	Misc Kulakovskiy et al.(2013) NR2E3_MOUSE.H11MO.0.C	0.967	0.814
NR2E3 M00372_2.00	Homo sapiens	AAAGATCA	TGATCTTT	PBM Barrera et al.(2016) NR2E3_R77Q	0.967	0.800
NR2E3 M00370_2.00	Homo sapiens	NNNWRABATCANN	NNTGATVTYWNNN	PBM Barrera et al.(2016) NR2E3_R76Q	0.962	0.800
NR2E3 M00371_2.00	Homo sapiens	NNNHAATWTRTNN	NNAYAWATTDNNN	PBM Barrera et al.(2016) NR2E3_R76W	0.956	0.800
NR2E3 M00369_2.00	Homo sapiens	NGGGRTCAHN	NDTGAYCCCN	PBM Barrera et al.(2016) NR2E3_G56R	0.949	0.800
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SMU15038222	Nuclear receptor	86	156	LCCVVCGDVSSGKHYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNK

Links
Other Nuclear receptor family TFs
Other *Schmidtea mediterranea* TFs

Invalid Input OrderBy

168 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action