TF Information

Minc11307 *(Meloidogyne incognita)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00105 (zf-C4)	IPR001628	Minc11307	T307399_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
nhr-49 M02413_2.00	Caenorhabditis elegans	NNNNWNHAN	NTDNWNNNN	PBM Weirauch et al.(2014) pTH5891	0.868	0.557
nhr-34 M00690_2.00	Caenorhabditis elegans	NNNNDHYRNN	NNYRDHNNNN	PBM Narasimhan et al.(2015) pTH9907	0.798	0.514
nhr-154 M00698_2.00	Caenorhabditis elegans	NRBRYCAHWD	HWDTGRYVYN	PBM Narasimhan et al.(2015) pTH10650	0.762	0.486
CBG23380 M01296_2.00	Caenorhabditis briggsae	NDBDHHANWN	NWNTDDHVHN	PBM Lambert et al.(2019) pTH11449	0.760	0.486
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Minc11307	Nuclear receptor	67	136	DFCVVCNDKAIGKHYGAVSCNGCKGFFRRTVWQNLQYSCRFSNNCKVDKTRRNACRACRFKKCLIEGMRI

Links
Other Nuclear receptor family TFs
Other *Meloidogyne incognita* TFs

Invalid Input OrderBy

221 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action