TF Information

ENSP00000367545 *(Macaca fascicularis)* p53
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00870 (P53)	IPR011615	ENSP00000367545	T311236_2.00	GigaDB (2015-Oct-22)
NCBI Gene Info: This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined. [provided by RefSeq, Feb 2011]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Trp73 M03438_2.00	Mus musculus	DRCAWGTYNNRACAYGYH	DRCRTGTYNNRACWTGYH	SELEX Jolma et al.(2013) Tp73_1	0.990	0.990
TP73 M08035_2.00	Homo sapiens	RCADGYHSDGRCWDG	CHWGYCHSDRCHTGY	ChIP-seq Chen et al.(2011) GSE15704_TP73_rapamycin	0.990	0.990
TP73 M08036_2.00	Homo sapiens	DRRCAWGYHCWGRCWTGYH	DRCAWGYCWGDRCWTGYYH	ChIP-seq Chen et al.(2011) GSE15704_TP73_vehicle	0.990	0.990
TP73 M08037_2.00	Homo sapiens	RCMDGYBCHNDCHKG	CMDGHNDGVRCHKGY	ChIP-seq Chen et al.(2011) GSE18650_TP73	0.990	0.990
TP73 M09336_2.00	Homo sapiens	NDDCHWGYYCMRRCHTGYH	DRCADGYYKGRRCWDGHHN	Misc Kulakovskiy et al.(2013) P73_HUMAN.H11MO.0.A	0.990	0.990
Trp73 M09339_2.00	Mus musculus	NDDCHWGYYCMRRCHTGYH	DRCADGYYKGRRCWDGHHN	Misc Kulakovskiy et al.(2013) P73_MOUSE.H11MO.0.B	0.990	0.990
TP73 M11196_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$P73_Q6	0.990	0.990
Trp63 M09338_2.00	Mus musculus	DRCAWGYHCHRRCHTGYHN	NDRCADGYYDGDRCWTGYH	Misc Kulakovskiy et al.(2013) P63_MOUSE.H11MO.0.B	0.857	0.857
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSP00000367545	p53	113	309	PVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHY

Links
Other p53 family TFs
Other *Macaca fascicularis* TFs

Invalid Input OrderBy

124 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action