TF Information

NV16807 *(Nasonia vitripennis)* Paired box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00292 (PAX)	IPR001523	NV16807	T312013_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
sv M01302_2.00	Drosophila melanogaster	NNNSCRBRDM	KHYVYGSNNN	PBM Lambert et al.(2019) pTH9773	0.793	0.793
sv M03949_2.00	Drosophila melanogaster	NBCRNYSAWGCGTGACS	SGTCACGCWTSRNYGVN	SELEX Nitta et al.(2015) sv_1	0.793	0.793
sv M06438_2.00	Drosophila melanogaster	RNYSRDSCGTRACNN	NNGTYACGSHYSRNY	B1H Zhu et al.(2011) sv_SOLEXA_5_FBgn0005561	0.793	0.793
pax2b M02425_2.00	Danio rerio	HVNYSRNSCR	YGSNYSRNBD	PBM Weirauch et al.(2014) pTH8679	0.713	0.713
pax2 M02428_2.00	Xenopus tropicalis	NNNRNBCRNN	NNYGVNYNNN	PBM Weirauch et al.(2014) pTH8556	0.713	0.713
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
NV16807-PA	Paired box	8	95	HCDHRTRSDTRRYLLMSVEIRRYYETGSFKAGVIGGSKPKVATPPVVDAIANYKRDNPTMFAWEIRDRLLAEGICSQDNVPSVSSINR

Links
Other Paired box family TFs
Other *Nasonia vitripennis* TFs

Invalid Input OrderBy

45 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action