TF Information

CLEC006156 *(Cimex lectularius)* Paired box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00292 (PAX)	IPR001523	CLEC006156	T312225_2.00	Misc (2018-Jan-19)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Poxn M03946_2.00	Drosophila melanogaster	DGCGTGACSGTCACGSY	RSCGTGACSGTCACGCH	SELEX Nitta et al.(2015) Poxn_1	0.819	0.819
Poxn M03947_2.00	Drosophila melanogaster	RSCGKGACSGTTMCGSW	WSCGKAACSGTCMCGSY	SELEX Nitta et al.(2015) Poxn_2	0.819	0.819
Poxn M03948_2.00	Drosophila melanogaster	NCGTTCCGGAACGD	HCGTTCCGGAACGN	SELEX Nitta et al.(2015) Poxn_3	0.819	0.819
Poxn M06437_2.00	Drosophila melanogaster	RSCGTGACG	CGTCACGSY	B1H Zhu et al.(2011) Poxn_SOLEXA_5_FBgn0003130	0.819	0.819
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CLEC006156-PA	Paired box	1	95	MGVRPCDISRQLLVSHGCVSKILTRFYETGSIRPGSIGATKTKQVATPSVVKRILRCKQENPGMFAWEIREKLLSQRNCEPHSVPSVSSVNRILR

Links
Other Paired box family TFs
Other *Cimex lectularius* TFs

Invalid Input OrderBy

20 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action