TF Information

ACUA016445 *(Anopheles culicifacies)* Paired box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00292 (PAX)	IPR001523	ACUA016445	T312374_2.00	Vectorbase (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Poxn M03946_2.00	Drosophila melanogaster	DGCGTGACSGTCACGSY	RSCGTGACSGTCACGCH	SELEX Nitta et al.(2015) Poxn_1	0.800	0.800
Poxn M03947_2.00	Drosophila melanogaster	RSCGKGACSGTTMCGSW	WSCGKAACSGTCMCGSY	SELEX Nitta et al.(2015) Poxn_2	0.800	0.800
Poxn M03948_2.00	Drosophila melanogaster	NCGTTCCGGAACGD	HCGTTCCGGAACGN	SELEX Nitta et al.(2015) Poxn_3	0.800	0.800
Poxn M06437_2.00	Drosophila melanogaster	RSCGTGACG	CGTCACGSY	B1H Zhu et al.(2011) Poxn_SOLEXA_5_FBgn0003130	0.800	0.800
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ACUA016445-PA	Paired box	70	159	SQAGVNQLGGVFVNGRPLPDIVRRRIVELALMGVRPCDISRQLLVSHGCVSKILTRFYETGSIRPGSIGGSKTKGIITFIGKDPNDLQGG

Links
Other Paired box family TFs
Other *Anopheles culicifacies* TFs

Invalid Input OrderBy

47 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action