TF Information

NBR_0002110501 *(Nippostrongylus brasiliensis)* Paired box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00292 (PAX)	IPR001523	NBR_0002110501	T312815_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Poxm M03944_2.00	Drosophila melanogaster	CAVTCAWGCGTGACR	YGTCACGCWTGABTG	SELEX Nitta et al.(2015) Poxm_1	0.705	0.705
Poxm M03945_2.00	Drosophila melanogaster	NYSAWGCRTRACS	SGTYAYGCWTSRN	SELEX Nitta et al.(2015) Poxm_2	0.705	0.705
Poxm M06436_2.00	Drosophila melanogaster	NNNNNNMVNHNRNSCRTGA	TCAYGSNYNDNBKNNNNNN	B1H Zhu et al.(2011) Poxm_SOLEXA_5_FBgn0003129	0.705	0.705
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
NBR_0002110501-mRNA-1	Paired box	15	92	ASRESQRRRYVENGSIEPGTIGGSKPRVTTPKVVEYIRLLKFSDPGIFSWEIRDRLVNDGICSKDNCPSVSSISRILR

Links
Other Paired box family TFs
Other *Nippostrongylus brasiliensis* TFs

Invalid Input OrderBy

43 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action