TF Information

CpipJ_CPIJ002469 *(Culex pipiens)* Rel
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00554 (RHD_DNA_bind)	IPR011539	CpipJ_CPIJ002469	T316955_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
dl M02712_2.00	Drosophila melanogaster	SGGGKTTTTYCV	BGRAAAAMCCCS	SELEX Mathelier et al.(2014) MA0022.1	0.799	0.799
dl M02713_2.00	Drosophila melanogaster	GGGGWWTTCC	GGAAWWCCCC	SELEX Mathelier et al.(2014) MA0023.1	0.799	0.799
dl M09691_2.00	Drosophila melanogaster	BRGRWTTYCCM	KGGRAAWYCYV	Misc Kulakovskiy et al.(2009) dl	0.799	0.799
dl M11243_2.00	Drosophila melanogaster	GGGTTTTTCCV	BGGAAAAACCC	Transfac Matys et al.(2006) I$DL_01	0.799	0.799
dl M11244_2.00	Drosophila melanogaster	BRDTTTTCYSD	HSRGAAAAHYV	Transfac Matys et al.(2006) I$DL_02	0.799	0.799
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CpipJ_CPIJ002469-RA	Rel	11	181	VVITEQPQSKALRFRYECEGRSAGSIPGVHSTPEQKTFPSIEVRGYKGRAVVVVSCVTKDPPYRPHPHNLVGKEGCKKGVCTVEINSASMSYTFSNLGIQCVKKKDIEEALRLREEIRVDPFKTGYSHAKQPATIDLNAVRLCFQVFLEGQQRGRFTEPLQPVVSDVIYDK

Links
Other Rel family TFs
Other *Culex pipiens* TFs

Invalid Input OrderBy

54 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action