TF Information

ENSBTAP00000049624-D1 *(Bos grunniens)* Rel
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00554 (RHD_DNA_bind)	IPR011539	ENSBTAP00000049624-D1	T317766_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RELB M08161_2.00	Homo sapiens	NNATTCCCCNN	NNGGGGAATNN	ChIP-seq Mathelier et al.(2014) MA1117.1	0.798	0.798
RELB M09347_2.00	Homo sapiens	VGGGRMTTTSMH	DKSAAAKYCCCB	Misc Kulakovskiy et al.(2013) RELB_HUMAN.H11MO.0.C	0.798	0.798
RELB M11227_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$RELBP50_Q3	0.798	0.798
Relb M09352_2.00	Mus musculus	VGGGRMTTTSMH	DKSAAAKYCCCB	Misc Kulakovskiy et al.(2013) RELB_MOUSE.H11MO.0.C	0.779	0.779
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSBTAP00000049624-D1	Rel	133	300	VAKSQRQLSNFHFRTEGQEAGWISPHPKCLRWDLKSTVFLQLRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDK

Links
Other Rel family TFs
Other *Bos grunniens* TFs

Invalid Input OrderBy

32 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action