CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ACHR009253 *(Anopheles christyi)* Rel
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00554 (RHD_DNA_bind)	IPR011539	ACHR009253	T317889_2.00	Vectorbase (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
dl M02712_2.00	Drosophila melanogaster	SGGGKTTTTYCV	BGRAAAAMCCCS	SELEX Mathelier et al.(2014) MA0022.1	0.734	0.734
dl M02713_2.00	Drosophila melanogaster	GGGGWWTTCC	GGAAWWCCCC	SELEX Mathelier et al.(2014) MA0023.1	0.734	0.734
dl M09691_2.00	Drosophila melanogaster	BRGRWTTYCCM	KGGRAAWYCYV	Misc Kulakovskiy et al.(2009) dl	0.734	0.734
dl M11243_2.00	Drosophila melanogaster	GGGTTTTTCCV	BGGAAAAACCC	Transfac Matys et al.(2006) I$DL_01	0.734	0.734
dl M11244_2.00	Drosophila melanogaster	BRDTTTTCYSD	HSRGAAAAHYV	Transfac Matys et al.(2006) I$DL_02	0.734	0.734
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ACHR009253-PA	Rel	116	287	VEITEQPHPKALRFRYECEGRSAGSIPGVSTTAEHKTFPSIQVHGYRGRAVVVVSCVTKEGPDHKPHPHNLVGKEGCKKGVCTVEINSTTMSYTFNNLGIQCVKKKDVEEALRLRQEIRVDPYRTGFGHAKEPGSIDLNAVRLCFQVFLEGQQRGRFTEPLTPVVSDIIYDK

Links
Other Rel family TFs
Other *Anopheles christyi* TFs

49 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
WUBG_07365	Wuchereria bancrofti	WUBG_07365	N	0.000
nLs.2.1.2.g08119	Litomosoides sigmodontis	nLs.2.1.2.g08119	N	0.000
NBR_0000528201	Nippostrongylus brasiliensis	NBR_0000528201	N	0.000
L892_g10863	Steinernema scapterisci	L892_g10863	N	0.000
ALUE_0001309901	Ascaris lumbricoides	ALUE_0001309901	N	0.000
LDEC015816	Leptinotarsa decemlineata	LDEC015816	N	0.000
Hsal_17691--NA	Harpegnathos saltator	Hsal_17691--NA	N	0.000
Hsal_09927--NA	Harpegnathos saltator	Hsal_09927--NA	N	0.000
Hsal_04211--NA	Harpegnathos saltator	Hsal_04211--NA	N	0.000
Cflo_14905--NA	Camponotus floridanus	Cflo_14905--NA	N	0.000
NV15844	Nasonia vitripennis	NV15844	N	0.000
MCINX013767	Melitaea cinxia	MCINX013767	N	0.000
CGI_10026391	Crassostrea gigas	CGI_10026391	N	0.000
ACYPI45228	Acyrthosiphon pisum	ACYPI45228	N	0.000
ACYPI061276	Acyrthosiphon pisum	ACYPI061276	N	0.000
ACEP11313	Atta cephalotes	ACEP11313	N	0.000
WUBG_15783	Wuchereria bancrofti	WUBG_15783	N	0.000
WUBG_08619	Wuchereria bancrofti	WUBG_08619	N	0.000
nOo.2.0.1.g10794	Onchocerca ochengi	nOo.2.0.1.g10794	N	0.000