TF Information

Traes_7DS_405F08A53 *(Triticum aestivum)* RWP-RK
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02042 (RWP-RK)	IPR003035	Traes_7DS_405F08A53	T320882_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RKD2 M07249_2.00	Arabidopsis thaliana	NHGWCBNTTCRDCTTCYHN	NDRGAAGHYGAANVGWCDN	Dap-seq OMalley et al.(2016) RKD2_col_a	0.735	0.735
RKD2 M07250_2.00	Arabidopsis thaliana	GWCBBTTCRDMTTCC	GGAAKHYGAAVVGWC	Dap-seq OMalley et al.(2016) RKD2_colamp_a	0.735	0.735
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_7DS_405F08A53.1	RWP-RK	142	190	VLTFELVSQYFYMPITQAARELNVGLTVLKKKCRELGIPRWPHRKLKNL

Links
Other RWP-RK family TFs
Other *Triticum aestivum* TFs

Invalid Input OrderBy

96 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action