TF Information

PDK_20s1383532g001 *(Phoenix dactylifera)* RWP-RK
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF02042 (RWP-RK)	IPR003035	PDK_20s1383532g001	T321328_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RKD2 M07249_2.00	Arabidopsis thaliana	NHGWCBNTTCRDCTTCYHN	NDRGAAGHYGAANVGWCDN	Dap-seq OMalley et al.(2016) RKD2_col_a	0.735	0.735
RKD2 M07250_2.00	Arabidopsis thaliana	GWCBBTTCRDMTTCC	GGAAKHYGAAVVGWC	Dap-seq OMalley et al.(2016) RKD2_colamp_a	0.735	0.735
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PDK_20s1383532g001	RWP-RK	50	98	ALTFEEVSHYFYMPITQAAKELNIGVTLLKKKCRELGIPRWPHRKLKSL

Links
Other RWP-RK family TFs
Other *Phoenix dactylifera* TFs

Invalid Input OrderBy

93 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action