TF Information

CPIJ007045 *(Culex quinquefasciatus)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	CPIJ007045	T321599_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Deaf1 M06445_2.00	Drosophila melanogaster	VMCGAR	YTCGKB	B1H Zhu et al.(2011) Deaf1_FlyReg_FBgn0013799	0.875	0.707
Deaf1 M07544_2.00	Drosophila melanogaster	VMCGAR	YTCGKB	DNaseI footprinting Mathelier et al.(2014) MA0185.1	0.875	0.707
Deaf1 M11268_2.00	Drosophila melanogaster	Transfac license required	Transfac license required	Transfac Matys et al.(2006) I$DEAF_01	0.875	0.707
Deaf1 M11269_2.00	Drosophila melanogaster	Transfac license required	Transfac license required	Transfac Matys et al.(2006) I$DEAF1_Q6	0.875	0.707
DEAF1 M11266_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_01	0.864	0.640
DEAF1 M11267_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_02	0.864	0.640
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CPIJ007045-PA	SAND	146	220	SNIDVLPVRCKTTTGELYKSRLGSGGRGKCIKHKDGWYTPSEFENICGRGSSKDWKRSIRYGGRSLQALIDEGIL

Links
Other SAND family TFs
Other *Culex quinquefasciatus* TFs

Invalid Input OrderBy

118 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action