TF Information

ENSAMEG00000010859 *(Ailuropoda melanoleuca)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSAMEG00000010859	T321608_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AIRE M09375_2.00	Homo sapiens	DHVHCCWWHWNWWCCNND	HNNGGWWNWDWWGGDBDH	Misc Kulakovskiy et al.(2013) AIRE_HUMAN.H11MO.0.C	0.906	0.682
AIRE M11264_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_01	0.906	0.682
AIRE M11265_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_02	0.906	0.682
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSAMEP00000011418	SAND	194	262	TVSSGDVPGACGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPIGGKNKTRSSGLKTLVRAKGTQ

Links
Other SAND family TFs
Other *Ailuropoda melanoleuca* TFs

Invalid Input OrderBy

24 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action