TF Information

AIRE *(Bos taurus)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSBTAG00000023393	T321624_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AIRE M09375_2.00	Homo sapiens	DHVHCCWWHWNWWCCNND	HNNGGWWNWDWWGGDBDH	Misc Kulakovskiy et al.(2013) AIRE_HUMAN.H11MO.0.C	0.888	0.714
AIRE M11264_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_01	0.888	0.714
AIRE M11265_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_02	0.888	0.714
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSBTAP00000031798	SAND	205	270	SGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPNKFEDPAGGKNKTRSSSLKTLVRAKGTQ

Links
Other SAND family TFs
Other *Bos taurus* TFs

Invalid Input OrderBy

21 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action