TF Information

ENSCSAG00000007836 *(Chlorocebus sabaeus)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSCSAG00000007836	T321657_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AIRE M09375_2.00	Homo sapiens	DHVHCCWWHWNWWCCNND	HNNGGWWNWDWWGGDBDH	Misc Kulakovskiy et al.(2013) AIRE_HUMAN.H11MO.0.C	0.975	0.846
AIRE M11264_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_01	0.975	0.846
AIRE M11265_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_02	0.975	0.846
Aire M09376_2.00	Mus musculus	DHVHCCWWHWNWWCCNND	HNNGGWWNWDWWGGDBDH	Misc Kulakovskiy et al.(2013) AIRE_MOUSE.H11MO.0.C	0.954	0.827
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSCSAP00000004087	SAND	196	248	SGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPGGGKNKARS

Links
Other SAND family TFs
Other *Chlorocebus sabaeus* TFs

Invalid Input OrderBy

31 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action