TF Information

DEAF1 *(Microcebus murinus)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSMICG00000001602	T321766_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DEAF1 M11266_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_01	0.990	0.972
DEAF1 M11267_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_02	0.990	0.972
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMICP00000001456	SAND	172	246	SVYDSELPVRCRNISGTLYKSRLGSGGRGRCIKQGESWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQXXX

Links
Other SAND family TFs
Other *Microcebus murinus* TFs

Invalid Input OrderBy

88 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action