TF Information

AIRE *(Procavia capensis)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSPCAG00000007455	T321860_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AIRE M09375_2.00	Homo sapiens	DHVHCCWWHWNWWCCNND	HNNGGWWNWDWWGGDBDH	Misc Kulakovskiy et al.(2013) AIRE_HUMAN.H11MO.0.C	0.943	0.782
AIRE M11264_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_01	0.943	0.782
AIRE M11265_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AIRE_02	0.943	0.782
Aire M09376_2.00	Mus musculus	DHVHCCWWHWNWWCCNND	HNNGGWWNWDWWGGDBDH	Misc Kulakovskiy et al.(2013) AIRE_MOUSE.H11MO.0.C	0.859	0.709
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSPCAP00000007005	SAND	196	250	GDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEEPGSSGGKNKTRSS

Links
Other SAND family TFs
Other *Procavia capensis* TFs

Invalid Input OrderBy

24 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action